PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.005G012200.1
Common NamePHAVU_005G012200g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family EIL
Protein Properties Length: 560aa    MW: 63138.5 Da    PI: 7.1133
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.005G012200.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3352.11.1e-107304051353
                         XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
                EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsL 91 
                         eel++rmw+d+m l++lke+k++    ke+        ++ e +++k+  raQD +Lk M+k+me+c a+GfvYgiipekgkpv+gasd+L
  Phvul.005G012200.1  30 EELERRMWRDRMMLRKLKEEKRE----KEK-------GETMEMMKKKALIRAQDTVLKNMVKMMEICGARGFVYGIIPEKGKPVSGASDNL 109
                         8*****************99997....333.......24579999********************************************** PP

                         XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHH CS
                EIN3  92 raWWkekvefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwg 182
                         raWWke v+fd ngpaai  y+ +    +   +    +s +  +ls+l+DTtlgSLLs+lmq cdppqrr+pl+kg++pPWWPtG+e ww+
  Phvul.005G012200.1 110 RAWWKERVKFDHNGPAAIQRYEEESGFDDMVGDAFDGESPTTYTLSDLPDTTLGSLLSSLMQNCDPPQRRYPLDKGTAPPWWPTGQEWWWA 200
                         *********************6665554444444334789999************************************************ PP

                         HHT--TT--.-----GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXX..XXXXXXXX CS
                EIN3 183 elglskdqgtppykkphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsah..ssslrkqs 271
                         ++g+s d g+ppykkphdlkk+wk+ vL avikh+sp+i++ir+ ++ s+ lqdk +ake++++ +++++ee+ +++ ++h   ++l  + 
  Phvul.005G012200.1 201 QMGFSMDPGPPPYKKPHDLKKVWKICVLIAVIKHISPDIAKIRNIVLHSRTLQDKLTAKETAIWNAIVKREESFARRSYPHffHHTLPPRP 291
                         *********************************************************************************6333333333 PP

                         XXXXXXXXXXXXXX...XXXXXX.XXXXXXXXXX.......................................XXXXXXXXXXXXXXXXXX CS
                EIN3 272 pkvtlsceqkedve...gkkeskikhvqavktta.......................................gfpvvrkrkkkpsesakv 320
                         p + +++  k  +     +++++ ++v +v +++                                       +  +v+krk   ++ + +
  Phvul.005G012200.1 292 PPIAYDK--KFTNFlggLNNKPQPNNVANVGARNffvgqfnpppptsnvaiangnnnnnnmltmmnrgtvmplDH-AVEKRK--GGDVQGI 377
                         3333333..333334564555555666666666688899999999999999999999998888887666654332.233333..2333333 PP

                         XXX......XXXXXXX.XXXXXXXXXXXXXXXX CS
                EIN3 321 sskevsrtcqssqfrgsetelifadknsisqne 353
                            +  + c++ ++      ++f+d+n +++++
  Phvul.005G012200.1 378 TFPHQAYSCHNIEC-----GFGFSDRNTRNNHQ 405
                         33333455555555.....58999999999887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048739.1E-10530272No hitNo description
Gene3DG3DSA:1.10.3180.102.0E-62148281IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167687.98E-54152275IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
PROSITE profilePS501578.808384415IPR007087Zinc finger, C2H2
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046872Molecular Functionmetal ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 560 aa     Download sequence    Send to blast
MDSMDAVIFC DDPSKRNVEE ESEEEVVTVE ELERRMWRDR MMLRKLKEEK REKEKGETME  60
MMKKKALIRA QDTVLKNMVK MMEICGARGF VYGIIPEKGK PVSGASDNLR AWWKERVKFD  120
HNGPAAIQRY EEESGFDDMV GDAFDGESPT TYTLSDLPDT TLGSLLSSLM QNCDPPQRRY  180
PLDKGTAPPW WPTGQEWWWA QMGFSMDPGP PPYKKPHDLK KVWKICVLIA VIKHISPDIA  240
KIRNIVLHSR TLQDKLTAKE TAIWNAIVKR EESFARRSYP HFFHHTLPPR PPPIAYDKKF  300
TNFLGGLNNK PQPNNVANVG ARNFFVGQFN PPPPTSNVAI ANGNNNNNNM LTMMNRGTVM  360
PLDHAVEKRK GGDVQGITFP HQAYSCHNIE CGFGFSDRNT RNNHQLTCQY RSRNPLQVVG  420
SDRNIGASVT NQNQSFTDMG CGVMNNMNVE QKQSTGVGSS MNVAPLAGQN QNVQRVQTEE  480
NGLFDGRFCL EKDMFGSNMY VPSLASKTEQ QVQNVHSLNG NLSTSIIVDP PIAWDANNSQ  540
AEFLDSPLLT TPDKDILWP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4zds_A1e-571502802132Protein ETHYLENE INSENSITIVE 3
4zds_B1e-571502802132Protein ETHYLENE INSENSITIVE 3
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150401e-162AP015040.1 Vigna angularis var. angularis DNA, chromosome 7, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007148764.10.0hypothetical protein PHAVU_005G012200g
TrEMBLV7BUP70.0V7BUP7_PHAVU; Uncharacterized protein
STRINGGLYMA06G47181.11e-173(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF32234200
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G27050.11e-104ETHYLENE-INSENSITIVE3-like 1